SCOPe 2.07: Domain d1bgys_: 1bgy S:

Lineage for d1bgys_ (1bgy S:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
   Uniprot P13271 #SP ! Uniprot P13271

8. Domain d1bgys_: 1bgy S: [43693]
   Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyh_, d1bgyi_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgyt_, d1bgyu_, d1bgyv_, d1bgyw_
   complexed with fes, hec, hem

Details for d1bgys_

PDB Entry: 1bgy, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (S:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgys_:

Sequence; same for both SEQRES and ATOM records:

>d1bgys_ f.23.13.1 (S:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayendr

Timeline for d1bgys_:

• d1bgys_ first appeared (with stable ids) in SCOP 1.55, called d1bgys1
  
• d1bgys_ appears in SCOPe 2.06
  
• d1bgys_ appears in the current release, SCOPe 2.08