Lineage for d1bgyr_ (1bgy R:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027685Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 3027686Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 3027687Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 3027688Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 3027699Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries)
    Uniprot P00129
  8. 3027715Domain d1bgyr_: 1bgy R: [43692]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyg_, d1bgyh_, d1bgyi_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgys_, d1bgyt_, d1bgyu_, d1bgyv_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgyr_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (R:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyr_ f.27.1.1 (R:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d1bgyr_:

Click to download the PDB-style file with coordinates for d1bgyr_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyr_: