Details for d1bgyp3

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (P:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyp3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyp3 f.23.11.1 (P:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1bgyp3 are not available.

Timeline for d1bgyp3:

Domains from same chain:
(mouse over for more information)
d1bgyp2