Lineage for d1bgyo1 (1bgy O:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201866Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 201867Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 201912Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 201937Domain d1bgyo1: 1bgy O: [43689]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyd2, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyp2, d1bgyq1

Details for d1bgyo1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyo1 f.2.1.8 (O:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
lilvlmptagtienkllkw

SCOP Domain Coordinates for d1bgyo1:

Click to download the PDB-style file with coordinates for d1bgyo1.
(The format of our PDB-style files is described here.)

Timeline for d1bgyo1: