Lineage for d1bgyj_ (1bgy J:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698406Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1698407Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1698408Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 1698419Species Cow (Bos taurus) [TaxId:9913] [81509] (18 PDB entries)
    Uniprot P00130
  8. 1698439Domain d1bgyj_: 1bgy J: [43687]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyi_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyu_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgyj_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (J:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

SCOPe Domain Coordinates for d1bgyj_:

Click to download the PDB-style file with coordinates for d1bgyj_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyj_: