Details for d1bgyj_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyj_ f.23.14.1 (J:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

SCOP Domain Coordinates for d1bgyj_:

Click to download the PDB-style file with coordinates for d1bgyj_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyj_: