Details for d1bgyg_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayendr

SCOP Domain Coordinates for d1bgyg_:

Click to download the PDB-style file with coordinates for d1bgyg_.
(The format of our PDB-style files is described here.)

Timeline for d1bgyg_: