Lineage for d1bgyg1 (1bgy G:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 39135Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 39136Protein Cytochrome bc1 transmembrane subunits [56907] (2 species)
  7. 39159Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 39180Domain d1bgyg1: 1bgy G: [43685]
    Other proteins in same PDB: d1bgya_, d1bgyb_, d1bgyd2, d1bgym_, d1bgyn_, d1bgyp2, d1bgyq1

Details for d1bgyg1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyg1 f.2.1.8 (G:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayendr

SCOP Domain Coordinates for d1bgyg1:

Click to download the PDB-style file with coordinates for d1bgyg1.
(The format of our PDB-style files is described here.)

Timeline for d1bgyg1: