Lineage for d1bgye_ (1bgy E:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631229Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2631230Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 2631231Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)
  7. 2631247Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 2631268Domain d1bgye_: 1bgy E: [43683]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyi_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq1, d1bgyr_, d1bgys_, d1bgyt_, d1bgyu_, d1bgyv_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgye_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (E:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgye_ f.23.12.1 (E:) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvlamskie

SCOPe Domain Coordinates for d1bgye_:

Click to download the PDB-style file with coordinates for d1bgye_.
(The format of our PDB-style files is described here.)

Timeline for d1bgye_: