Details for d1bgye_

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgye_ f.23.12.1 (E:) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvlamskie

SCOP Domain Coordinates for d1bgye_:

Click to download the PDB-style file with coordinates for d1bgye_.
(The format of our PDB-style files is described here.)

Timeline for d1bgye_: