Details for d1bgyd3

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (D:) cytochrome bc1 complex

SCOPe Domain Sequences for d1bgyd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOPe Domain Coordinates for d1bgyd3:

Click to download the PDB-style file with coordinates for d1bgyd3.
(The format of our PDB-style files is described here.)

Timeline for d1bgyd3: