Lineage for d1bgyc1 (1bgy C:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 39135Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 39136Protein Cytochrome bc1 transmembrane subunits [56907] (2 species)
  7. 39159Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 39176Domain d1bgyc1: 1bgy C: [43681]
    Other proteins in same PDB: d1bgya_, d1bgyb_, d1bgyd2, d1bgym_, d1bgyn_, d1bgyp2, d1bgyq1

Details for d1bgyc1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyc1 f.2.1.8 (C:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
lilvlmptagtienkllkw

SCOP Domain Coordinates for d1bgyc1:

Click to download the PDB-style file with coordinates for d1bgyc1.
(The format of our PDB-style files is described here.)

Timeline for d1bgyc1: