SCOP 1.65: Domain d1qcrj_: 1qcr J:

Lineage for d1qcrj_ (1qcr J:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (1 protein)

6. Protein Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
   inteacts with cytochrome c1 and ISP

7. Species Cow (Bos taurus) [TaxId:9913] [81509] (5 PDB entries)

8. Domain d1qcrj_: 1qcr J: [43679]
   Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrk_
   complexed with hem

Details for d1qcrj_

PDB Entry: 1qcr, 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrj_:

Sequence; same for both SEQRES and ATOM records:

>d1qcrj_ f.23.14.1 (J:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
tltarlysllfrrtstfaltivvgalfferafdngadaiyehinegklwkhikhkyenk

Timeline for d1qcrj_:

• d1qcrj_ first appeared (with stable ids) in SCOP 1.55, called d1qcrj1
  
• d1qcrj_ appears in SCOP 1.63
  
• d1qcrj_ appears in SCOP 1.67
  
• d1qcrj_ appears in the current release, SCOPe 2.08