Lineage for d1qcrj1 (1qcr J:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87917Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 87918Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 87949Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 87964Domain d1qcrj1: 1qcr J: [43679]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrd2, d1qcre1

Details for d1qcrj1

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrj1 f.2.1.8 (J:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
tltarlysllfrrtstfaltivvgalfferafdngadaiyehinegklwkhikhkyenk

SCOP Domain Coordinates for d1qcrj1:

Click to download the PDB-style file with coordinates for d1qcrj1.
(The format of our PDB-style files is described here.)

Timeline for d1qcrj1: