![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() automatically mapped to Pfam PF02939 |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
![]() | Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries) Uniprot P13271 #SP ! Uniprot P13271 |
![]() | Domain d1qcrg_: 1qcr G: [43677] Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrh_, d1qcrj_, d1qcrk_ complexed with hem |
PDB Entry: 1qcr (more details), 2.7 Å
SCOPe Domain Sequences for d1qcrg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcrg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefeksk
Timeline for d1qcrg_: