SCOP 1.67: Domain d1qcrg_: 1qcr G:

Lineage for d1qcrg_ (1qcr G:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (9 PDB entries)

8. Domain d1qcrg_: 1qcr G: [43677]
   Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrh_, d1qcrj_, d1qcrk_
   complexed with hem

Details for d1qcrg_

PDB Entry: 1qcr, 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrg_:

Sequence; same for both SEQRES and ATOM records:

>d1qcrg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefeksk

Timeline for d1qcrg_:

• d1qcrg_ first appeared (with stable ids) in SCOP 1.55, called d1qcrg1
  
• d1qcrg_ appears in SCOP 1.65
  
• d1qcrg_ appears in SCOP 1.69
  
• d1qcrg_ appears in the current release, SCOPe 2.08