Lineage for d1qcrg_ (1qcr G:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340933Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 340934Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)
  6. 340935Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 340946Species Cow (Bos taurus) [TaxId:9913] [81503] (5 PDB entries)
  8. 340950Domain d1qcrg_: 1qcr G: [43677]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrc3, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrh_, d1qcrj_, d1qcrk_
    complexed with hem

Details for d1qcrg_

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefeksk

SCOP Domain Coordinates for d1qcrg_:

Click to download the PDB-style file with coordinates for d1qcrg_.
(The format of our PDB-style files is described here.)

Timeline for d1qcrg_: