Lineage for d1qcrg1 (1qcr G:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201866Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 201867Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 201912Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 201925Domain d1qcrg1: 1qcr G: [43677]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrd2, d1qcre1

Details for d1qcrg1

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrg1 f.2.1.8 (G:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefeksk

SCOP Domain Coordinates for d1qcrg1:

Click to download the PDB-style file with coordinates for d1qcrg1.
(The format of our PDB-style files is described here.)

Timeline for d1qcrg1: