Lineage for d1qcrc1 (1qcr C:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 39135Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 39136Protein Cytochrome bc1 transmembrane subunits [56907] (2 species)
  7. 39159Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 39168Domain d1qcrc1: 1qcr C: [43673]
    Other proteins in same PDB: d1qcra_, d1qcrb_, d1qcrd2, d1qcre1

Details for d1qcrc1

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only

SCOP Domain Sequences for d1qcrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrc1 f.2.1.8 (C:) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
ilvlmptagtienkllkw

SCOP Domain Coordinates for d1qcrc1:

Click to download the PDB-style file with coordinates for d1qcrc1.
(The format of our PDB-style files is described here.)

Timeline for d1qcrc1: