![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() automatically mapped to Pfam PF05365 |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries) Uniprot P00130 |
![]() | Domain d1be3j_: 1be3 J: [43671] Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3k_ complexed with fes, hec, hem |
PDB Entry: 1be3 (more details), 3 Å
SCOPe Domain Sequences for d1be3j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1be3j_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye nk
Timeline for d1be3j_: