Lineage for d1be3h_ (1be3 H:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888118Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 888119Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 888120Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 888121Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 888137Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries)
    Uniprot P00126
  8. 888156Domain d1be3h_: 1be3 H: [43670]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3g_, d1be3j_, d1be3k_
    complexed with fes, hec, hem

Details for d1be3h_

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (H:) cytochrome bc1 complex

SCOP Domain Sequences for d1be3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3h_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
nslk

SCOP Domain Coordinates for d1be3h_:

Click to download the PDB-style file with coordinates for d1be3h_.
(The format of our PDB-style files is described here.)

Timeline for d1be3h_: