SCOP 1.73: Domain d1be3g_: 1be3 G:

Lineage for d1be3g_ (1be3 G:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries)

8. Domain d1be3g_: 1be3 G: [43669]
   Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3f_, d1be3h_, d1be3j_, d1be3k_
   complexed with fes, hec, hem

Details for d1be3g_

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (G:) cytochrome bc1 complex

SCOP Domain Sequences for d1be3g_:

Sequence; same for both SEQRES and ATOM records:

>d1be3g_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaayendr

Timeline for d1be3g_:

• d1be3g_ first appeared (with stable ids) in SCOP 1.55, called d1be3g1
  
• d1be3g_ appears in SCOP 1.71
  
• d1be3g_ appears in SCOP 1.75
  
• d1be3g_ appears in the current release, SCOPe 2.08