SCOPe 2.08: Domain d1be3f_: 1be3 F:

Lineage for d1be3f_ (1be3 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (14 PDB entries)
   Uniprot P00129

8. Domain d1be3f_: 1be3 F: [43668]
   Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3e2, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_
   complexed with fes, hec, hem

Details for d1be3f_

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (F:) cytochrome bc1 complex

SCOPe Domain Sequences for d1be3f_:

Sequence; same for both SEQRES and ATOM records:

>d1be3f_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1be3f_:

• d1be3f_ first appeared (with stable ids) in SCOP 1.55, called d1be3f1
  
• d1be3f_ appears in SCOPe 2.07