SCOPe 2.07: Domain d1be3e2: 1be3 E:1-69

Lineage for d1be3e2 (1be3 E:1-69)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries)
   Uniprot P13272; precursor of chains I,E and V,R

8. Domain d1be3e2: 1be3 E:1-69 [43667]
   Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_
   complexed with fes, hec, hem

Details for d1be3e2

PDB Entry: 1be3, 3 Å

PDB Description: cytochrome bc1 complex from bovine

PDB Compounds: (E:) cytochrome bc1 complex

SCOPe Domain Sequences for d1be3e2:

Sequence; same for both SEQRES and ATOM records:

>d1be3e2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d1be3e2:

• d1be3e2 first appeared (with stable ids) in SCOP 1.55
  
• d1be3e2 appears in SCOPe 2.06
  
• d1be3e2 appears in the current release, SCOPe 2.08