Lineage for d1be3e2 (1be3 E:1-69)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958070Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 1958071Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 1958072Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 1958088Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 1958106Domain d1be3e2: 1be3 E:1-69 [43667]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e1, d1be3f_, d1be3g_, d1be3h_, d1be3i_, d1be3j_, d1be3k_
    complexed with fes, hec, hem

Details for d1be3e2

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine
PDB Compounds: (E:) cytochrome bc1 complex

SCOPe Domain Sequences for d1be3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3e2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1be3e2:

Click to download the PDB-style file with coordinates for d1be3e2.
(The format of our PDB-style files is described here.)

Timeline for d1be3e2: