Lineage for d1be3d3 (1be3 D:196-241)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142085Family f.2.1.8: Cytochrome bc1 transmembrane subunits [56906] (1 protein)
  6. 142086Protein Cytochrome bc1 transmembrane subunits [56907] (3 species)
  7. 142117Species Cow (Bos taurus) [TaxId:9913] [56908] (3 PDB entries)
  8. 142119Domain d1be3d3: 1be3 D:196-241 [43666]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3d2, d1be3e1

Details for d1be3d3

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3d3 f.2.1.8 (D:196-241) Cytochrome bc1 transmembrane subunits {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d1be3d3:

Click to download the PDB-style file with coordinates for d1be3d3.
(The format of our PDB-style files is described here.)

Timeline for d1be3d3: