SCOP 1.55: Domain d1f6gd_: 1f6g D:

Lineage for d1f6gd_ (1f6g D:)

1. Root: SCOP 1.55

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.6: Potassium chanel protein [56900] (1 protein)

6. Protein Potassium chanel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (2 PDB entries)

8. Domain d1f6gd_: 1f6g D: [43659]

Details for d1f6gd_

PDB Entry: 1f6g

PDB Description: potassium channel (kcsa) full-length fold

SCOP Domain Sequences for d1f6gd_:

Sequence; same for both SEQRES and ATOM records:

>d1f6gd_ f.2.1.6 (D:) Potassium chanel protein {Streptomyces lividans}
mppmlsgllarlvklllgrhgsalhwaaagaatvllvivllagsylavlaergapgaqli
typaalwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
rrghfvrhsekaaeeaytrttralherfdrlermlddnrr

Timeline for d1f6gd_:

• d1f6gd_ appears in SCOP 1.57
  
• d1f6gd_ appears in the current release, SCOPe 2.08