Lineage for d1fx8a_ (1fx8 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629731Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 2629732Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 2629733Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 2629766Protein Glycerol uptake facilitator protein GlpF [56898] (1 species)
    glycerol conducting channel, related to aquaporin
  7. 2629767Species Escherichia coli [TaxId:562] [56899] (4 PDB entries)
  8. 2629768Domain d1fx8a_: 1fx8 A: [43651]
    complexed with bog, gol

Details for d1fx8a_

PDB Entry: 1fx8 (more details), 2.2 Å

PDB Description: crystal structure of the e. coli glycerol facilitator (glpf) with substrate glycerol
PDB Compounds: (A:) glycerol uptake facilitator protein

SCOPe Domain Sequences for d1fx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx8a_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli [TaxId: 562]}
tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
vgafayrkligrhl

SCOPe Domain Coordinates for d1fx8a_:

Click to download the PDB-style file with coordinates for d1fx8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fx8a_: