Lineage for d1fqya_ (1fqy A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629731Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 2629732Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 2629733Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 2629759Protein Aquaporin-1 [56896] (2 species)
  7. 2629762Species Human (Homo sapiens) [TaxId:9606] [56897] (3 PDB entries)
  8. 2629763Domain d1fqya_: 1fqy A: [43649]

Details for d1fqya_

PDB Entry: 1fqy (more details), 3.8 Å

PDB Description: structure of aquaporin-1 at 3.8 a resolution by electron crystallography
PDB Compounds: (A:) aquaporin-1

SCOPe Domain Sequences for d1fqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqya_ f.19.1.1 (A:) Aquaporin-1 {Human (Homo sapiens) [TaxId: 9606]}
klfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsv
ghisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrn
dladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidyt
gcginparsfgsavithnfsnhwifwvgpfiggalavliydfilap

SCOPe Domain Coordinates for d1fqya_:

Click to download the PDB-style file with coordinates for d1fqya_.
(The format of our PDB-style files is described here.)

Timeline for d1fqya_: