SCOP 1.61: Domain d1fqya_: 1fqy A:

Lineage for d1fqya_ (1fqy A:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.5: Aquaporin-like [56895] (2 proteins)

6. Protein Aquaporin-1 [56896] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56897] (3 PDB entries)

8. Domain d1fqya_: 1fqy A: [43649]

Details for d1fqya_

PDB Entry: 1fqy, 3.8 Å

PDB Description: structure of aquaporin-1 at 3.8 a resolution by electron crystallography

SCOP Domain Sequences for d1fqya_:

Sequence; same for both SEQRES and ATOM records:

>d1fqya_ f.2.1.5 (A:) Aquaporin-1 {Human (Homo sapiens)}
klfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsv
ghisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrn
dladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidyt
gcginparsfgsavithnfsnhwifwvgpfiggalavliydfilap

Timeline for d1fqya_:

• d1fqya_ first appeared (with stable ids) in SCOP 1.55
  
• d1fqya_ appears in SCOP 1.59
  
• d1fqya_ appears in SCOP 1.63
  
• d1fqya_ appears in the current release, SCOPe 2.08