Lineage for d1fqya_ (1fqy A:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87909Family f.2.1.5: Aquaporin-like [56895] (2 proteins)
  6. 87910Protein Aquaporin-1 [56896] (1 species)
  7. 87911Species Human (Homo sapiens) [TaxId:9606] [56897] (2 PDB entries)
  8. 87913Domain d1fqya_: 1fqy A: [43649]

Details for d1fqya_

PDB Entry: 1fqy (more details), 3.8 Å

PDB Description: structure of aquaporin-1 at 3.8 a resolution by electron crystallography

SCOP Domain Sequences for d1fqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqya_ f.2.1.5 (A:) Aquaporin-1 {Human (Homo sapiens)}
klfwravvaeflattlfvfisigsalgfkypvgnnqtavqdnvkvslafglsiatlaqsv
ghisgahlnpavtlglllscqisifralmyiiaqcvgaivatailsgitssltgnslgrn
dladgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsaplaiglsvalghllaidyt
gcginparsfgsavithnfsnhwifwvgpfiggalavliydfilap

SCOP Domain Coordinates for d1fqya_:

Click to download the PDB-style file with coordinates for d1fqya_.
(The format of our PDB-style files is described here.)

Timeline for d1fqya_: