Lineage for d1c17c_ (1c17 C:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142043Family f.2.1.4: F1F0 ATP synthase subunits [56890] (2 proteins)
  6. 142047Protein Subunit C [56891] (1 species)
  7. 142048Species Escherichia coli [TaxId:562] [56892] (5 PDB entries)
  8. 142053Domain d1c17c_: 1c17 C: [43638]
    Other proteins in same PDB: d1c17m_

Details for d1c17c_

PDB Entry: 1c17 (more details)

PDB Description: a1c12 subcomplex of f1fo atp synthase

SCOP Domain Sequences for d1c17c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c17c_ f.2.1.4 (C:) Subunit C {Escherichia coli}
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava

SCOP Domain Coordinates for d1c17c_:

Click to download the PDB-style file with coordinates for d1c17c_.
(The format of our PDB-style files is described here.)

Timeline for d1c17c_: