Lineage for d1ffth_ (1fft H:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457734Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1457735Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 1457736Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1457745Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species)
  7. 1457746Species Escherichia coli [TaxId:562] [81449] (1 PDB entry)
  8. 1457748Domain d1ffth_: 1fft H: [43632]
    Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftf_, d1fftg1, d1fftg2
    complexed with cu, hem, heo

Details for d1ffth_

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (H:) ubiquinol oxidase

SCOPe Domain Sequences for d1ffth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffth_ f.25.1.1 (H:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]}
hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
ylmga

SCOPe Domain Coordinates for d1ffth_:

Click to download the PDB-style file with coordinates for d1ffth_.
(The format of our PDB-style files is described here.)

Timeline for d1ffth_: