Lineage for d1fftg2 (1fft G:27-117)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456154Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1456176Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1456177Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1456215Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species)
  7. 1456216Species Escherichia coli [TaxId:562] [81461] (1 PDB entry)
  8. 1456218Domain d1fftg2: 1fft G:27-117 [43631]
    Other proteins in same PDB: d1ffta_, d1fftb1, d1fftc_, d1fftf_, d1fftg1, d1ffth_
    complexed with cu, hem, heo

Details for d1fftg2

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (G:) ubiquinol oxidase

SCOPe Domain Sequences for d1fftg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftg2 f.17.2.1 (G:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli [TaxId: 562]}
salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
kveavvwtvpiliiiflavltwktthaleps

SCOPe Domain Coordinates for d1fftg2:

Click to download the PDB-style file with coordinates for d1fftg2.
(The format of our PDB-style files is described here.)

Timeline for d1fftg2: