SCOP 1.59: Domain d1fftg2: 1fft G:27-117

Lineage for d1fftg2 (1fft G:27-117)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (11 families)

5. Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)

6. Protein Ubiquinol oxidase [56888] (1 species)

7. Species Escherichia coli [TaxId:562] [56889] (1 PDB entry)

8. Domain d1fftg2: 1fft G:27-117 [43631]
   Other proteins in same PDB: d1fftb1, d1fftg1

Details for d1fftg2

PDB Entry: 1fft

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftg2:

Sequence; same for both SEQRES and ATOM records:

>d1fftg2 f.2.1.3 (G:27-117) Ubiquinol oxidase {Escherichia coli}
salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
kveavvwtvpiliiiflavltwktthaleps

Timeline for d1fftg2:

• d1fftg2 first appeared (with stable ids) in SCOP 1.55
  
• d1fftg2 appears in SCOP 1.57
  
• d1fftg2 appears in SCOP 1.61
  
• d1fftg2 appears in the current release, SCOPe 2.08