Lineage for d1fftc_ (1fft C:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958717Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1958718Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 1958719Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1958728Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species)
  7. 1958729Species Escherichia coli [TaxId:562] [81449] (1 PDB entry)
  8. 1958730Domain d1fftc_: 1fft C: [43629]
    Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftf_, d1fftg1, d1fftg2
    complexed with cu, hem, heo

Details for d1fftc_

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli
PDB Compounds: (C:) ubiquinol oxidase

SCOPe Domain Sequences for d1fftc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]}
hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
ylmga

SCOPe Domain Coordinates for d1fftc_:

Click to download the PDB-style file with coordinates for d1fftc_.
(The format of our PDB-style files is described here.)

Timeline for d1fftc_: