SCOPe 2.05: Domain d1fftc_: 1fft C:

Lineage for d1fftc_ (1fft C:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species)

7. Species Escherichia coli [TaxId:562] [81449] (1 PDB entry)

8. Domain d1fftc_: 1fft C: [43629]
   Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftf_, d1fftg1, d1fftg2
   complexed with cu, hem, heo

Details for d1fftc_

PDB Entry: 1fft, 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

PDB Compounds: (C:) ubiquinol oxidase

SCOPe Domain Sequences for d1fftc_:

Sequence; same for both SEQRES and ATOM records:

>d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli [TaxId: 562]}
hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
ylmga

Timeline for d1fftc_:

• d1fftc_ first appeared (with stable ids) in SCOP 1.55, called d1fftc1
  
• d1fftc_ appears in SCOPe 2.04
  
• d1fftc_ is called d1fftc2 in SCOPe 2.06
  
• d1fftc_ appears in the current release, SCOPe 2.08, called d1fftc2