Lineage for d1fftc_ (1fft C:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520365Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 520366Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 520367Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 520376Protein Cytochrome O ubiquinol oxidase, subunit III [81450] (1 species)
  7. 520377Species Escherichia coli [TaxId:562] [81449] (1 PDB entry)
  8. 520378Domain d1fftc_: 1fft C: [43629]
    Other proteins in same PDB: d1ffta_, d1fftb1, d1fftb2, d1fftf_, d1fftg1, d1fftg2

Details for d1fftc_

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftc_ f.25.1.1 (C:) Cytochrome O ubiquinol oxidase, subunit III {Escherichia coli}
hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
ylmga

SCOP Domain Coordinates for d1fftc_:

Click to download the PDB-style file with coordinates for d1fftc_.
(The format of our PDB-style files is described here.)

Timeline for d1fftc_: