SCOP 1.55: Domain d1fftc1: 1fft C:

Lineage for d1fftc1 (1fft C:)

1. Root: SCOP 1.55

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)

6. Protein Ubiquinol oxidase [56888] (1 species)

7. Species Escherichia coli [TaxId:562] [56889] (1 PDB entry)

8. Domain d1fftc1: 1fft C: [43629]
   Other proteins in same PDB: d1fftb1, d1fftg1

Details for d1fftc1

PDB Entry: 1fft

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftc1:

Sequence; same for both SEQRES and ATOM records:

>d1fftc1 f.2.1.3 (C:) Ubiquinol oxidase {Escherichia coli}
hdaggtkifgfwiylmsdcilfsilfatyavlvngtaggptgkdifelpfvlvetflllf
ssitygmaaiamyknnksqviswlaltwlfgagfigmeiyefhhlivngmgpdrsgflsa
ffalvgthglhvtsgliwmavlmvqiarrgltstnrtrimclslfwhfldvvwicvftvv
ylmga

Timeline for d1fftc1:

• d1fftc1 appears in SCOP 1.57
  
• d1fftc1 appears in the current release, SCOPe 2.08, called d1fftc2