SCOP 1.67: Domain d1fftb2: 1fft B:27-117

Lineage for d1fftb2 (1fft B:27-117)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species)

7. Species Escherichia coli [TaxId:562] [81461] (1 PDB entry)

8. Domain d1fftb2: 1fft B:27-117 [43628]
   Other proteins in same PDB: d1ffta_, d1fftb1, d1fftc_, d1fftf_, d1fftg1, d1ffth_

Details for d1fftb2

PDB Entry: 1fft, 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftb2:

Sequence; same for both SEQRES and ATOM records:

>d1fftb2 f.17.2.1 (B:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli}
salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
kveavvwtvpiliiiflavltwktthaleps

Timeline for d1fftb2:

• d1fftb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fftb2 appears in SCOP 1.65
  
• d1fftb2 appears in SCOP 1.69
  
• d1fftb2 appears in the current release, SCOPe 2.08