Lineage for d1fftb2 (1fft B:27-117)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267886Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
    two antiparallel transmembrane helices
  4. 267906Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 267907Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 267920Protein Cytochrome O ubiquinol oxidase, subunit II [81462] (1 species)
  7. 267921Species Escherichia coli [TaxId:562] [81461] (1 PDB entry)
  8. 267922Domain d1fftb2: 1fft B:27-117 [43628]
    Other proteins in same PDB: d1ffta_, d1fftb1, d1fftc_, d1fftf_, d1fftg1, d1ffth_

Details for d1fftb2

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftb2 f.17.2.1 (B:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli}
salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn
kveavvwtvpiliiiflavltwktthaleps

SCOP Domain Coordinates for d1fftb2:

Click to download the PDB-style file with coordinates for d1fftb2.
(The format of our PDB-style files is described here.)

Timeline for d1fftb2: