Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) |
Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein) |
Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
Species Thermus thermophilus [TaxId:274] [81470] (2 PDB entries) |
Domain d1ehkc_: 1ehk C: [43626] Other proteins in same PDB: d1ehka_, d1ehkb1, d1ehkb2 complexed with 1cu, bng, cua, has, hem |
PDB Entry: 1ehk (more details), 2.4 Å
SCOP Domain Sequences for d1ehkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehkc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} eekpkgalavilvltltilvfwlgvyavffarg
Timeline for d1ehkc_: