SCOP 1.69: Domain d1ehkb2: 1ehk B:3-40

Lineage for d1ehkb2 (1ehk B:3-40)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81459] (1 PDB entry)
   the "missing" first helix is complemented by the ba3 subunit IIa

8. Domain d1ehkb2: 1ehk B:3-40 [43625]
   Other proteins in same PDB: d1ehka_, d1ehkb1, d1ehkc_

Details for d1ehkb2

PDB Entry: 1ehk, 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkb2:

Sequence; same for both SEQRES and ATOM records:

>d1ehkb2 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus}
dehkahkailayekgwlafslamlfvfialiaytlath

Timeline for d1ehkb2:

• d1ehkb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ehkb2 appears in SCOP 1.67
  
• d1ehkb2 appears in SCOP 1.71
  
• d1ehkb2 appears in the current release, SCOPe 2.08