Lineage for d1ehkb2 (1ehk B:3-40)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519697Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
    two antiparallel transmembrane helices
  4. 519719Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 519720Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 519730Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 519731Species Thermus thermophilus [TaxId:274] [81459] (1 PDB entry)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 519732Domain d1ehkb2: 1ehk B:3-40 [43625]
    Other proteins in same PDB: d1ehka_, d1ehkb1, d1ehkc_

Details for d1ehkb2

PDB Entry: 1ehk (more details), 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehkb2 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus}
dehkahkailayekgwlafslamlfvfialiaytlath

SCOP Domain Coordinates for d1ehkb2:

Click to download the PDB-style file with coordinates for d1ehkb2.
(The format of our PDB-style files is described here.)

Timeline for d1ehkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ehkb1