Lineage for d1ehka_ (1ehk A:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887788Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 887789Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 887790Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (4 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 887804Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 887805Species Thermus thermophilus [TaxId:274] [81437] (2 PDB entries)
  8. 887807Domain d1ehka_: 1ehk A: [43624]
    Other proteins in same PDB: d1ehkb1, d1ehkb2, d1ehkc_
    complexed with 1cu, bng, cua, has, hem

Details for d1ehka_

PDB Entry: 1ehk (more details), 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus
PDB Compounds: (A:) ba3-type cytochrome-c oxidase

SCOP Domain Sequences for d1ehka_:

Sequence, based on SEQRES records: (download)

>d1ehka_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
srerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghl
npvpgwrlw

Sequence, based on observed residues (ATOM records): (download)

>d1ehka_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
srlaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghlnpvpg
wrlw

SCOP Domain Coordinates for d1ehka_:

Click to download the PDB-style file with coordinates for d1ehka_.
(The format of our PDB-style files is described here.)

Timeline for d1ehka_: