Lineage for d1ehka1 (1ehk A:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201689Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 201690Protein Cytochrome c oxidase [56884] (4 species)
  7. 201816Species Thermus thermophilus, ba3 type [TaxId:274] [56887] (1 PDB entry)
  8. 201817Domain d1ehka1: 1ehk A: [43624]
    Other proteins in same PDB: d1ehkb1

Details for d1ehka1

PDB Entry: 1ehk (more details), 2.4 Å

PDB Description: crystal structure of the aberrant ba3-cytochrome-c oxidase from thermus thermophilus

SCOP Domain Sequences for d1ehka1:

Sequence, based on SEQRES records: (download)

>d1ehka1 f.2.1.3 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
srerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghl
npvpgwrlw

Sequence, based on observed residues (ATOM records): (download)

>d1ehka1 f.2.1.3 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type}
aypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqgltlhg
vlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpllaneatvly
tfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavvfwlmw
flaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpayaiiytilpk
qaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavpslmta
ftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnasftldy
vvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlwflgmm
imavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiyglfsvll
srlaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvqlfghlnpvpg
wrlw

SCOP Domain Coordinates for d1ehka1:

Click to download the PDB-style file with coordinates for d1ehka1.
(The format of our PDB-style files is described here.)

Timeline for d1ehka1: