Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) automatically mapped to Pfam PF07835 |
Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (1 protein) |
Protein Bacterial aa3 type cytochrome c oxidase subunit IV [81467] (2 species) interacts with subunit I and III, function unknown, non-essential for the enzymatic activity |
Species Paracoccus denitrificans [TaxId:266] [81465] (1 PDB entry) |
Domain d1qled_: 1qle D: [43623] Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qlec_, d1qleh_, d1qlel_ complexed with ca, cu, cua, hea, mn, pc1 |
PDB Entry: 1qle (more details), 3 Å
SCOPe Domain Sequences for d1qled_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qled_ f.23.8.1 (D:) Bacterial aa3 type cytochrome c oxidase subunit IV {Paracoccus denitrificans [TaxId: 266]} tdhkhgemdirhqqatfagfikgatwvsilsiavlvflalans
Timeline for d1qled_: