Lineage for d1qlec_ (1qle C:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 620698Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 620699Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 620700Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 620701Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species)
  7. 620702Species Paracoccus denitrificans [TaxId:266] [81446] (1 PDB entry)
  8. 620703Domain d1qlec_: 1qle C: [43622]
    Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qled_, d1qleh_, d1qlel_

Details for d1qlec_

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qlec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlec_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Paracoccus denitrificans}
ahvknhdyqilppsiwpffgaigafvmltgavawmkgitffglpvegpwmfliglvgvly
vmfgwwadvvnegetgehtpvvriglqygfilfimsevmffvawfwafiknalypmgpds
pikdgvwppegivtfdpwhlplintlilllsgvavtwahhafvlegdrkttinglivavi
lgvcftglqayeyshaafgladtvyagafymatgfhgahviigtiflfvclirllkgqmt
qkqhvgfeaaawywhfvdvvwlflfvviyiwgr

SCOP Domain Coordinates for d1qlec_:

Click to download the PDB-style file with coordinates for d1qlec_.
(The format of our PDB-style files is described here.)

Timeline for d1qlec_: