Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organised into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Bacterial aa3 type cytochrome c oxidase subunit III [81448] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [81446] (1 PDB entry) |
Domain d1qlec_: 1qle C: [43622] Other proteins in same PDB: d1qlea_, d1qleb1, d1qleb2, d1qled_, d1qleh_, d1qlel_ |
PDB Entry: 1qle (more details), 3 Å
SCOP Domain Sequences for d1qlec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlec_ f.25.1.1 (C:) Bacterial aa3 type cytochrome c oxidase subunit III {Paracoccus denitrificans} ahvknhdyqilppsiwpffgaigafvmltgavawmkgitffglpvegpwmfliglvgvly vmfgwwadvvnegetgehtpvvriglqygfilfimsevmffvawfwafiknalypmgpds pikdgvwppegivtfdpwhlplintlilllsgvavtwahhafvlegdrkttinglivavi lgvcftglqayeyshaafgladtvyagafymatgfhgahviigtiflfvclirllkgqmt qkqhvgfeaaawywhfvdvvwlflfvviyiwgr
Timeline for d1qlec_: