Lineage for d1qlec1 (1qle C:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87754Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 87755Protein Cytochrome c oxidase [56884] (3 species)
  7. 87857Species Paracoccus denitrificans [TaxId:266] [56886] (2 PDB entries)
  8. 87862Domain d1qlec1: 1qle C: [43622]
    Other proteins in same PDB: d1qleb1, d1qleh_, d1qlel_

Details for d1qlec1

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qlec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlec1 f.2.1.3 (C:) Cytochrome c oxidase {Paracoccus denitrificans}
ahvknhdyqilppsiwpffgaigafvmltgavawmkgitffglpvegpwmfliglvgvly
vmfgwwadvvnegetgehtpvvriglqygfilfimsevmffvawfwafiknalypmgpds
pikdgvwppegivtfdpwhlplintlilllsgvavtwahhafvlegdrkttinglivavi
lgvcftglqayeyshaafgladtvyagafymatgfhgahviigtiflfvclirllkgqmt
qkqhvgfeaaawywhfvdvvwlflfvviyiwgr

SCOP Domain Coordinates for d1qlec1:

Click to download the PDB-style file with coordinates for d1qlec1.
(The format of our PDB-style files is described here.)

Timeline for d1qlec1: