SCOP 1.75: Domain d1qleb2: 1qle B:1-107

Lineage for d1qleb2 (1qle B:1-107)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Bacterial aa3 type cytochrome c oxidase subunit II [81458] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [81456] (3 PDB entries)

8. Domain d1qleb2: 1qle B:1-107 [43621]
   Other proteins in same PDB: d1qlea_, d1qleb1, d1qlec_, d1qled_, d1qleh_, d1qlel_

Details for d1qleb2

PDB Entry: 1qle, 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOP Domain Sequences for d1qleb2:

Sequence; same for both SEQRES and ATOM records:

>d1qleb2 f.17.2.1 (B:1-107) Bacterial aa3 type cytochrome c oxidase subunit II {Paracoccus denitrificans [TaxId: 266]}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

Timeline for d1qleb2:

• d1qleb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qleb2 appears in SCOP 1.73
  
• d1qleb2 appears in SCOPe 2.01
  
• d1qleb2 appears in the current release, SCOPe 2.08