Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
Protein Cytochrome c oxidase [56884] (3 species) |
Species Paracoccus denitrificans [TaxId:266] [56886] (2 PDB entries) |
Domain d1qleb2: 1qle B:1-107 [43621] Other proteins in same PDB: d1qleb1, d1qleh_, d1qlel_ |
PDB Entry: 1qle (more details), 3 Å
SCOP Domain Sequences for d1qleb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qleb2 f.2.1.3 (B:1-107) Cytochrome c oxidase {Paracoccus denitrificans} qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp
Timeline for d1qleb2: